DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and Dsp1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:162 Identity:35/162 - (21%)
Similarity:55/162 - (33%) Gaps:45/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PKGRGRPRATYAQTGEFDLGLIRE--YRSHP------------------VLYDRSNKRF-----K 52
            |:||....|.:.||       .||  .:.||                  .:.|:..|||     |
  Fly   183 PRGRMTAYAYFVQT-------CREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEK 240

  Fly    53 DK-LYVAHIWEQIAHK-----LGYDATSIRERMTTLRNR------YNIEKRRVENGLSTQSSQWP 105
            || .|.|.:...:..|     .|.....|::.....|:.      .|.|:.:|: .|:.:.....
  Fly   241 DKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVK-ALNPEFGVGD 304

  Fly   106 LFESLQFLGDHIRPRRSFKNMSVKEEDEETYE 137
            :.:.|......:.|....|..|:.|.|:..||
  Fly   305 IAKELGRKWSDVDPEVKQKYESMAERDKARYE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 22/121 (18%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 19/75 (25%)
HMGB-UBF_HMG-box 275..339 CDD:238686 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.