DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and HMG20A

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001291433.1 Gene:HMG20A / 10363 HGNCID:5001 Length:347 Species:Homo sapiens


Alignment Length:327 Identity:67/327 - (20%)
Similarity:123/327 - (37%) Gaps:103/327 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSHLYPPQLPKGRGRPRATYAQTGEF--DLG---LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQ 63
            |:|   |::|...|...:|  ...||  ||.   |::...|:..  :.:.:|.:|        ||
Human    31 LNH---PEVPYSSGATSST--NNPEFVEDLSQGQLLQSESSNAA--EGNEQRHED--------EQ 80

  Fly    64 IAHKLGYDATSIRERMTTLRN------------RYNIEKR-------------RVENGLSTQSSQ 103
            .:.:.|:  :..|:|...||:            |:..|:|             .:...|..:.|:
Human    81 RSKRGGW--SKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSK 143

  Fly   104 WPLFESLQFLGDHIRPR-------------RSFKNMSVKEEDEE---TYEVDDCRSDSNGHMNSI 152
            .|..|..::|.:..|.:             .::|..|.|.:|.:   ::..|..|..::.|..  
Human   144 LPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQATHDHEK-- 206

  Fly   153 KDELEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQ-RSTNGEMPNGKGYNHFAE--SYHRRHQ 214
            :.|:::.| :||    :|:.|...:..:.:.||...| |.:|.|         |.|  :..::|.
Human   207 ETEVKERS-VFD----IPIFTEEFLNHSKAREAELRQLRKSNME---------FEERNAALQKHV 257

  Fly   215 NQPEYIISSPIVNPMRSNKRGS---QHLDDHPSKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGF 276
            ......:....|:.::...|.:   |||:   :.|:|..|...|        .|||       |.
Human   258 ESMRTAVEKLEVDVIQERSRNTVLQQHLE---TLRQVLTSSFAS--------MPLP-------GS 304

  Fly   277 GE 278
            ||
Human   305 GE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/109 (17%)
HMG20ANP_001291433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 21/98 (21%)
DUF5401 <59..313 CDD:375164 57/294 (19%)
HMGB-UBF_HMG-box 103..168 CDD:238686 9/64 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..211 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.