DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:256 Identity:57/256 - (22%)
Similarity:94/256 - (36%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKR--RVEN 95
            ||:...:.||||:.|...::........|.::|..:|......:.|..|:|:||..|:|  :::.
Zfish     9 LIQTVYAFPVLYNVSLHDYRSTERRVKAWREVAASVGLSVVECKRRWKTIRDRYIRERRLCKLKK 73

  Fly    96 GL-STQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDD 159
            .| ..:...||..|||.||..|||.||........||:::           ..|.::   .|::|
Zfish    74 DLGGRRLHYWPHRESLAFLDAHIRKRRRPSGAQGPEEEQQ-----------EEHSSA---ALQED 124

  Fly   160 SEIF--DCEQA--------LPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQ 214
            .|..  :|..:        |||:.:...|........:........:|.|........|      
Zfish   125 KECVSEECVDSGSRLAVSPLPVSIMSAPPPPQLKAVPQVSPLLLAALPPGLKVAPVCSS------ 183

  Fly   215 NQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRVDDSLSISGYYPT-QPLAPLPPAYAKFR 274
             ......:.|:..|:...:|....||        :|.|.:..|.|. :.|.|...|..|.:
Zfish   184 -ATGSASAGPLNVPLEEQQRADGALD--------EDQLFLLSYVPALKRLTPQKRAAVKMQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 26/87 (30%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 26/87 (30%)
BESS 208..242 CDD:281011 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.