DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jigr1 and LOC100330838

DIOPT Version :9

Sequence 1:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:137 Identity:32/137 - (23%)
Similarity:60/137 - (43%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRY----NIEKRRV 93
            ||.....:|.||:.:...:||....|..|..::.::.......|.|..:||:.:    ..|:||.
Zfish     9 LIAAVSDYPELYNSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQRRR 73

  Fly    94 ENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVD-DCRSDSNGHMNSIKDELE 157
            .:|.|.:|  |.....:.||...|:.|    :::..|.:|:..:.| |....::|:...:..:.|
Zfish    74 ASGTSHRS--WKYSWQMSFLTPFIQSR----SLAADEPEEDRDDEDKDEERTADGNSAFVVQDFE 132

  Fly   158 DDSEIFD 164
            .|..:.|
Zfish   133 GDHGMLD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jigr1NP_001097920.1 MADF 33..118 CDD:214738 22/88 (25%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 22/88 (25%)
BESS 167..200 CDD:397204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.