DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and HFD1

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_013828.1 Gene:HFD1 / 855137 SGDID:S000004716 Length:532 Species:Saccharomyces cerevisiae


Alignment Length:494 Identity:135/494 - (27%)
Similarity:217/494 - (43%) Gaps:100/494 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KVPNMT-VADAQKAIDAAKQAYESKEWR-----SLTAKD---RSNLLKKWHKLIEQHSQEIAEIM 115
            |:.|.| |:...:.::.::..:..|:.:     :...||   |...|||.:..::.|.:|:.:.|
Yeast     7 KILNYTPVSKIDEIVEISRNFFFEKQLKLSHENNPRKKDLEFRQLQLKKLYYAVKDHEEELIDAM 71

  Fly   116 TAESGKPINESKGEVAYGNAFVEWFAEEARRIYG------EIVPSASPNREI------------I 162
            .    |..:.:|         :|....|..::..      ||:|.....|.:            |
Yeast    72 Y----KDFHRNK---------IESVLNETTKLMNDILHLIEILPKLIKPRRVSDSSPPFMFGKTI 123

  Fly   163 VMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLAVDAGIPKGVI 227
            |.|...|...:|.|:|||:.:......||||||.|:|:||||.||.||:.:..|...||.|.|:|
Yeast   124 VEKISRGSVLIIAPFNFPLLLAFAPLAAALAAGNTIVLKPSELTPHTAVVMENLLTTAGFPDGLI 188

  Fly   228 NVV------TTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSADGIKRICLELGGNAPFIV 286
            .||      ||..      |.|...|:  |.:|||..||.::...:|..:....|||||.:|..:
Yeast   189 QVVQGAIDETTRL------LDCGKFDL--IFYTGSPRVGSIVAEKAAKSLTPCVLELGGKSPTFI 245

  Fly   287 ---FDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGCDV 348
               |.:::|:.|:.......|.|.||.|||.:...|..|:|.|.:.:               |: 
Yeast   246 TENFKASNIKIALKRIFFGAFGNSGQICVSPDYLLVHKSIYPKVIKE---------------CE- 294

  Fly   349 QIGPLINEM--QFNKVSGF---VEDARSKKA----NIILGGQPLPDKGSL--------FYAPTIV 396
               .::||.  .|::.:.|   :.:...|||    |...|.:.:|.|.|:        ...||||
Yeast   295 ---SVLNEFYPSFDEQTDFTRMIHEPAYKKAVASINSTNGSKIVPSKISINSDTEDLCLVPPTIV 356

  Fly   397 TDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKK---ANDTRRGLAGYFYSENLQQVFRVAKRLEV 458
            .::.....|..:|.|.||:.||.:.|.:|.:.|   .:||  .|..|.:|::..::.|:..||..
Yeast   357 YNIGWDDPLMKQENFAPVLPIIEYEDLDETINKIIEEHDT--PLVQYIFSDSQTEINRILTRLRS 419

  Fly   459 GMVGVNEGII--SAAEAPFGGVKESGVGREGSKHGIDDY 495
            |...|.:.:|  ...:|||||:..||.|..|..:|.:.:
Yeast   420 GDCVVGDTVIHVGITDAPFGGIGTSGYGNYGGYYGFNTF 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 135/494 (27%)
HFD1NP_013828.1 ALDH-SF 11..466 CDD:416387 133/490 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.