DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and Aldh8a1

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001178017.2 Gene:Aldh8a1 / 685750 RGDID:1590218 Length:487 Species:Rattus norvegicus


Alignment Length:489 Identity:164/489 - (33%)
Similarity:267/489 - (54%) Gaps:28/489 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAKDRS 94
            |.|...:::||         .:|:.|.|..||||....:.:.|:.||::|:.:  |.|.:.::||
  Rat    17 KFLPCNSYIDS---------YDPSTGEVYCKVPNSGKEEIEVAVQAAREAFPA--WSSRSPQERS 70

  Fly    95 NLLKKWHKLIEQHSQEIAEIMTAESGKPINESKG-EVAYGNAFVEWFAEEARRIYGEIVPSASPN 158
            .:|.:...::||..:|:|:..:.:.||.:..::. ::........:||...:....:....:...
  Rat    71 LILNRVADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSIQHHVSDCTEMSHLG 135

  Fly   159 REIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLAVDAGIP 223
            .....::.|:|:|.||:|||.|:.::|.|...|:|||.||:.||||.|.:||....||...||:|
  Rat   136 CMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSELTSVTAWMFCKLLDKAGVP 200

  Fly   224 KGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSADGIKRICLELGGNAPFIVFD 288
            .|||||| ......:|:.....|:|..||||||....:.:.:.||...|::.|||||..|.|:|:
  Rat   201 PGVINVV-FGTGPRVGEALVSHPEVPVISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFE 264

  Fly   289 SADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEAL---KIGDGQGCDVQI 350
            .|::|:.:...:.|.|.|.|:.|:..:|.|||.|:|::|   ||:.|||.   |:|........:
  Rat   265 DANLEECIPATVRSSFANQGEICLCTSRIFVQRSIYNEF---LKRFVEATRKWKVGIPSDPSANM 326

  Fly   351 GPLINEMQFNKVSGFVEDARSKKANIILG------GQPLPDKGSLFYAPTIVTDVPPSAQLYSEE 409
            |.||::....||..:|..|.::.|.|:.|      ..||.::...|..||::||:...:...:||
  Rat   327 GALISKAHLEKVRSYVTKAHAEGAKILCGEGVDQLSLPLRNQAGYFMLPTVITDIKDESCCMTEE 391

  Fly   410 VFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAP 474
            :||||..::.|..|||.:.:||..:.||....:|:::.::.||||||:.|:|..|..:|.....|
  Rat   392 IFGPVTCVVPFDSEEEVIARANGVKYGLGATVWSKDVGRIHRVAKRLQSGLVWTNCWLIRELNLP 456

  Fly   475 FGGVKESGVGREGSKHGIDDYVDIKYICMGNLKY 508
            |||:|.||:||||:|...|.:.:||.|   .:||
  Rat   457 FGGMKSSGIGREGAKDSYDFFTEIKTI---TIKY 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 158/463 (34%)
Aldh8a1NP_001178017.2 ALDH_F8_HMSADH 27..485 CDD:143412 159/475 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D899961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.