DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and ALDH7A1

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001173.2 Gene:ALDH7A1 / 501 HGNCID:877 Length:539 Species:Homo sapiens


Alignment Length:477 Identity:139/477 - (29%)
Similarity:240/477 - (50%) Gaps:17/477 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QDKALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAKD 92
            :::.:.:|:|........|:   .|||...|.:|...:|||.::.:..|::|:  |.|..:.|..
Human    50 ENEGVYNGSWGGRGEVITTY---CPANNEPIARVRQASVADYEETVKKAREAW--KIWADIPAPK 109

  Fly    93 RSNLLKKWHKLIEQHSQEIAEIMTAESGKPINESKGEVAYGNAFVEWFAEEARRIYGEIVPSASP 157
            |..::::....:.:..|.:..:::.|.||.:.|..|||.......::....:|.|.|.|:||...
Human   110 RGEIVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERS 174

  Fly   158 NREIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAV----AKLAV 218
            ...:|....|:|:..:||.:|||:|:.......|:..|...:.|.:..|.|.::||    ||:..
Human   175 GHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLE 239

  Fly   219 DAGIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSADGIKRICLELGGNAP 283
            |..:|..:.::  |...|.||....|...|..:||||||:|||.:.....:...|..||||||..
Human   240 DNKLPGAICSL--TCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGNNA 302

  Fly   284 FIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGCDV 348
            .|.|:.||:...|..|:.:.....||.|.:|.|.|:.:|::|:.|.:|||....:::|:....:|
Human   303 IIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNV 367

  Fly   349 QIGPLINEMQFNKVSGFVEDARSKKANIILGGQPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGP 413
            ..|||..:...:...|.||:|:.:...::.||:.: |:...:..|||||.:...|.:...|.|.|
Human   368 LYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVM-DRPGNYVEPTIVTGLGHDASIAHTETFAP 431

  Fly   414 VVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFR--VAKRLEVGMVGVNEGIISAAE--AP 474
            ::.:.:|::|||.....|:.::||:...::::|.::||  ..|..:.|:|.||.. .|.||  ..
Human   432 ILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIP-TSGAEIGGA 495

  Fly   475 FGGVKESGVGREGSKHGIDDYV 496
            |||.|.:|.|||........|:
Human   496 FGGEKHTGGGRESGSDAWKQYM 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 136/456 (30%)
ALDH7A1NP_001173.2 ALDH_F7_AASADH 53..527 CDD:143448 139/474 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.