DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and aldh1l1

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001011027.1 Gene:aldh1l1 / 496436 XenbaseID:XB-GENE-1016237 Length:902 Species:Xenopus tropicalis


Alignment Length:482 Identity:172/482 - (35%)
Similarity:287/482 - (59%) Gaps:10/482 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VQDKALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAK 91
            :..:..::|.::|:...| |::..||.:|..|.||....|:|..:|:.|||:|:|:.||..:..:
 Frog   420 IPHQLFINGQFIDAEGGK-TYDTVNPTDGTAICKVSLAQVSDIDRAVAAAKEAFENGEWGKMNPR 483

  Fly    92 DRSNLLKKWHKLIEQHSQEIAEIMTAESGKPINES-KGEVAYGNAFVEWFAEEARRIYGEIVP-- 153
            ||..:|.:...::|:|.:|:|.|.:.:||.....: |..|........:||....:|.|..:|  
 Frog   484 DRGRILYRLADIMEEHQEELATIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPIN 548

  Fly   154 SASPNREI-IVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLA 217
            .|.|||.: ...::||||..::.|||:|:.|:..|..|.||||.|||:||::.||||||..|:|:
 Frog   549 QARPNRNLTFTRREPIGVCGIVIPWNYPLMMLAWKTAACLAAGNTVVLKPAQVTPLTALKFAELS 613

  Fly   218 VDAGIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSADG-IKRICLELGGN 281
            |.|||||||||:: ....:.||......||||.|.|||||.:||.:.::.|.| :|::.|||||.
 Frog   614 VKAGIPKGVINIL-PGAGSLIGQRLSDHPDVRKIGFTGSTPIGKHIMKSCAVGNVKKVSLELGGK 677

  Fly   282 APFIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGC 346
            :|.|:|...|::|||...|:|.|.|.|:.|::|.|.|:::|::|:||.::...|:.:||||....
 Frog   678 SPLIIFQDCDLDKAVRMGMSSVFFNKGENCIAAGRLFLEESIHDEFVKRVVGEVKKMKIGDPLDR 742

  Fly   347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGGQPLPDKGSLFYAPTIVTDVPPSAQLYSEEVF 411
            ....||..::...:|:..:.:....:.|.::.||:.: ::...|:.|||.|||.....:..||.|
 Frog   743 STDHGPQNHKAHLDKLIEYCQTGVKEGAKLVYGGKQV-ERPGFFFEPTIFTDVTDEMFIAKEESF 806

  Fly   412 GPVVSIIRFR--DEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAP 474
            ||::.|.:|:  |.:|.:|:||:|..|||...:::::.:...|:::|:.|.|.||....:...||
 Frog   807 GPIMIISKFKDGDVDEVLKRANNTEFGLASGVFTKDISKALYVSEKLQAGTVFVNTYNKTDVAAP 871

  Fly   475 FGGVKESGVGREGSKHGIDDYVDIKYI 501
            |||.|:||.|::..:..:::|:..|.:
 Frog   872 FGGFKQSGFGKDLGEEALNEYLKTKAV 898

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 168/460 (37%)
aldh1l1NP_001011027.1 FMT_core_FDH_N 1..203 CDD:187716
GART 1..203
FDH_Hydrolase_C 206..305 CDD:187731
PP-binding 325..391 CDD:376348
ALDH_F1L_FTFDH 417..902 CDD:143458 172/482 (36%)
Aldehyde dehydrogenase 417..902 172/482 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.