DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and CG12516

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:216 Identity:38/216 - (17%)
Similarity:77/216 - (35%) Gaps:75/216 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 NAP--FIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDG 343
            |||  .::|:..|:..|:...:.|.........|:.  ..||:::.::...::|..::.|     
  Fly    84 NAPCMMVIFEDGDVNCALHHLVESLQDPFALDAVAV--ILVQEALAEEIENRVKILMKPL----- 141

  Fly   344 QGCDVQIGPLINEMQFNKVSGFVEDARSKKANIILG--GQPLPDKGSLFYAPTIVTDVP------ 400
               |.::.   |...:.:....:::.|.|   .|:|  .:.|||.     .|.:|.|:|      
  Fly   142 ---DARVA---NHPCYKRTLMKIDELRPK---TIIGPSDRVLPDA-----TPIMVRDIPHKFLGD 192

  Fly   401 ---------------PSAQLYSEEVFGPVVSIIRFRD-------------------------EEE 425
                           .:.|:|.:|...|:.|:..:.:                         :.|
  Fly   193 GPTGIITMHIFRTPFEATQIYRKEYPLPIASVSIWNERVSSVYDVIGMMNLLDTFKINCFTVDME 257

  Fly   426 AVKKANDTRRGLA----GYFY 442
            .:|:|.:.|:..|    ||.|
  Fly   258 PIKRAFELRKYSACIHRGYHY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 38/216 (18%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 38/216 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.