DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and CG8665

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_610107.1 Gene:CG8665 / 35407 FlyBaseID:FBgn0032945 Length:913 Species:Drosophila melanogaster


Alignment Length:482 Identity:167/482 - (34%)
Similarity:267/482 - (55%) Gaps:10/482 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VQDKALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAK 91
            |..:..::|.:|| :.|:.|.|:.||.|..|:.||...:..|..||:.||..|:.. .||.:|.:
  Fly   431 VPTQLFINGEFVD-AEAQRTLEIVNPTNEEVLCKVACASATDVDKAVRAAHSAFYG-SWRQITPR 493

  Fly    92 DRSNLLKKWHKLIEQHSQEIAEIMTAESGKPINES-KGEVAYGNAFVEWFAEEARRIYGEIVP-- 153
            .|..|:.....|:|::.:|:|.|.:.:||.....: |..|........:||....:|.|..:|  
  Fly   494 QRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQGNTIPVN 558

  Fly   154 SASPNREI-IVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLA 217
            .|.||..: ...|:||||..||||||:|:.|::.|..|.:|||.|.::||::..|||||..|:|.
  Fly   559 PARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAAGNTCLIKPAQTCPLTALKFAELT 623

  Fly   218 VDAGIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSAD-GIKRICLELGGN 281
            |.||.|.|||||: ..|.:..|........||.:.|||||.:||.:.::.|| .:|:..|||||.
  Fly   624 VRAGFPPGVINVL-PGKGSDAGQAVADHELVRKLGFTGSTPIGKHIMKSCADSNLKKCSLELGGK 687

  Fly   282 APFIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGC 346
            :|.|:|...|::|||...|:|.|.|.|:.|::|.|.||:|.::|:|:.::.|.:..:.|||....
  Fly   688 SPLIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRVLKDLRTMTIGDPLDR 752

  Fly   347 DVQIGPLINEMQFNKVSGFVEDARSKKANIILGGQPLPDKGSLFYAPTIVTDVPPSAQLYSEEVF 411
            ....||..::..|:|:..|......:.|.::.||..:|:....|:.||:.|:|.....:..||.|
  Fly   753 STAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRVPNLKGYFFTPTVFTNVTDDMFIAQEESF 817

  Fly   412 GPVVSIIRFR--DEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAP 474
            ||::.|.:|.  |.:..:::||.|..|||...:::::.:....|.|:|.|.|.||....:...||
  Fly   818 GPIMIISKFNGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIEAGTVFVNVYNKTDVAAP 882

  Fly   475 FGGVKESGVGREGSKHGIDDYVDIKYI 501
            |||.|:||.|::..:..:::|:..|.:
  Fly   883 FGGFKQSGYGKDLGQEALNEYLKTKCV 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 160/460 (35%)
CG8665NP_610107.1 Fmt 4..315 CDD:223301
FMT_core 5..207 CDD:294280
FDH_Hydrolase_C 212..316 CDD:187731
PP-binding 338..403 CDD:278949
PLN02466 396..909 CDD:215259 167/480 (35%)
ALDH_F1L_FTFDH 428..913 CDD:143458 167/482 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.