DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and Aldh8a1

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_848828.1 Gene:Aldh8a1 / 237320 MGIID:2653900 Length:487 Species:Mus musculus


Alignment Length:489 Identity:165/489 - (33%)
Similarity:269/489 - (55%) Gaps:28/489 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAKDRS 94
            |.|...:::||         .:|:.|.|..||||....:.:.|::||::|:.:  |.|.:.::||
Mouse    17 KFLPCNSYIDS---------YDPSTGEVYCKVPNSGKEEIEAAVEAAREAFPA--WSSRSPQERS 70

  Fly    95 NLLKKWHKLIEQHSQEIAEIMTAESGKPINESKG-EVAYGNAFVEWFAEEARRIYGEIVPSASPN 158
            .:|.:...::||..:|:|:..:.:.||.:..::. ::........:||........|....:...
Mouse    71 LVLNRLADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSNLHHVSECTQMSHLG 135

  Fly   159 REIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLAVDAGIP 223
            .....::.|:|:|.||:|||.|:.::|.|...|:|||.||:.||||.|.:||....||...||:|
Mouse   136 CMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSEMTSVTAWMFCKLLDKAGVP 200

  Fly   224 KGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSADGIKRICLELGGNAPFIVFD 288
            .||||:| ......:|:.....|:|..||||||....:.:.:.||...|::.|||||..|.|:|:
Mouse   201 PGVINIV-FGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFE 264

  Fly   289 SADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEAL---KIGDGQGCDVQI 350
            .|::|:.:...:.|.|.|.|:.|:..:|.|||.|:|.:|   ||:.|||.   |:|........:
Mouse   265 DANLEECIPATVRSSFANQGEICLCTSRIFVQRSIYSEF---LKRFVEATRKWKVGVPSDPSANM 326

  Fly   351 GPLINEMQFNKVSGFVEDARSKKANIILG------GQPLPDKGSLFYAPTIVTDVPPSAQLYSEE 409
            |.||::....||..:|..|:::.|.|:.|      ..||.::...|..||::||:...::..:||
Mouse   327 GALISKAHLEKVRSYVLKAQTEGARILCGEGVDQLSLPLRNQAGYFMLPTVITDIKDESRCMTEE 391

  Fly   410 VFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAP 474
            :||||..::.|..|||.:.:||..|.|||...:|:::.::.||||:|:.|:|..|..:|.....|
Mouse   392 IFGPVTCVVPFDSEEEVITRANSVRYGLAATVWSKDVGRIHRVAKKLQSGLVWTNCWLIRELNLP 456

  Fly   475 FGGVKESGVGREGSKHGIDDYVDIKYICMGNLKY 508
            |||:|.||:||||:|...|.:.:||.|   .:||
Mouse   457 FGGMKSSGIGREGAKDSYDFFTEIKTI---TIKY 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 159/463 (34%)
Aldh8a1NP_848828.1 ALDH_F8_HMSADH 27..485 CDD:143412 160/475 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.