DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and ALDH1L2

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001029345.2 Gene:ALDH1L2 / 160428 HGNCID:26777 Length:923 Species:Homo sapiens


Alignment Length:481 Identity:167/481 - (34%)
Similarity:283/481 - (58%) Gaps:10/481 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAKDRS 94
            :..::|.:.|:.:.| |::..||.:|:.|.||...::||..||:.|||.|:|:.||..:.|::|.
Human   444 QCFINGQFTDADDGK-TYDTINPTDGSTICKVSYASLADVDKAVAAAKDAFENGEWGRMNARERG 507

  Fly    95 NLLKKWHKLIEQHSQEIAEIMTAESGKPINES-KGEVAYGNAFVEWFAEEARRIYGEIVP--SAS 156
            .|:.:...|:|::.:|:|.|...:||.....: |..:........:||....:|.|..:|  .|.
Human   508 RLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQGSTIPINQAR 572

  Fly   157 PNREI-IVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLAVDA 220
            |||.: ...|:|:||.|:|.|||:|:.|:..|:.|.||||.|:|:||::.||||||..|:|:|.|
Human   573 PNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKA 637

  Fly   221 GIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSA-DGIKRICLELGGNAPF 284
            |.||||||:: .......|....:.||:|.:.|||||.:||.:.::.| ..:|::.|||||.:|.
Human   638 GFPKGVINII-PGSGGIAGQRLSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPL 701

  Fly   285 IVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGCDVQ 349
            |:|:..:::|||...|.:.|.|.|:.|::|.|.||::|::|:||.::.:.::.:||||.......
Human   702 IIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTD 766

  Fly   350 IGPLINEMQFNKVSGFVEDARSKKANIILGGQPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPV 414
            .||..::....|:..:.|....:.|.::.||:.:...| .|..||:.|||.....|..||.|||:
Human   767 HGPQNHKAHLEKLLQYCETGVKEGATLVYGGRQVQRPG-FFMEPTVFTDVEDYMYLAKEESFGPI 830

  Fly   415 VSIIRFR--DEEEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGG 477
            :.|.:|:  |.:..:::||.|..|||...::.::.:...|:::||.|.|.:|....:...|||||
Human   831 MVISKFQNGDIDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGG 895

  Fly   478 VKESGVGREGSKHGIDDYVDIKYICM 503
            ||:||.|::..:..:::|:..|.:.:
Human   896 VKQSGFGKDLGEEALNEYLKTKTVTL 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 163/460 (35%)
ALDH1L2NP_001029345.2 Fmt 22..326 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
GART 23..225
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..>390 CDD:278949
Aldehyde dehydrogenase 438..923 167/481 (35%)
ALDH_F1L_FTFDH 439..923 CDD:143458 167/481 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.