DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssadh and aldh1l2

DIOPT Version :9

Sequence 1:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_002938116.1 Gene:aldh1l2 / 100127737 XenbaseID:XB-GENE-5820495 Length:922 Species:Xenopus tropicalis


Alignment Length:479 Identity:171/479 - (35%)
Similarity:285/479 - (59%) Gaps:10/479 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAKDRS 94
            :..::|.:.|:.|.| |::..||.:|:||.||...:|||..||:.|||.|:|:.||..:.|:||.
 Frog   443 QCFINGQFADADNGK-TYDTINPTDGSVICKVAYCSVADVDKAVAAAKDAFENGEWGKMNARDRG 506

  Fly    95 NLLKKWHKLIEQHSQEIAEIMTAESGKPINES-KGEVAYGNAFVEWFAEEARRIYGEIVP--SAS 156
            .:|.:...|:|:|.:|:|.|...:||.....: |..|........:||....:|.|..:|  .|.
 Frog   507 RILYRLADLMEEHQEELATIEAIDSGAVYTLALKTHVGMSVQTFRYFAGWCDKIQGSTIPINQAR 571

  Fly   157 PNREI-IVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAVAKLAVDA 220
            |||.: ...|:|:||.|::.|||:|:.|:..|:.|.||||.|:|:||::.||||||..|:|||.|
 Frog   572 PNRNLTFTKKEPLGVCAIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELAVKA 636

  Fly   221 GIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSA-DGIKRICLELGGNAPF 284
            |:||||||:: ......:|....:.||:|.:.|||||.:||.:.::.| ..:|::.|||||.:|.
 Frog   637 GVPKGVINIL-PGSGGLVGQRLSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPL 700

  Fly   285 IVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKIGDGQGCDVQ 349
            |:|:..|::|||...|.:.:.|.|:.|::|.|.||::|::|:||.::.:.::.::|||.......
 Frog   701 IIFNDCDLDKAVRMGMGAVYFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMRIGDPLDRSTD 765

  Fly   350 IGPLINEMQFNKVSGFVEDARSKKANIILGGQPLPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPV 414
            .||..:.....|:..:.|....:.|.::.||:.:|..| .|..||:.|||.....|..||.|||:
 Frog   766 HGPQNHRAHLEKLLEYCEIGVKEGATLVYGGRKVPRPG-FFMEPTVFTDVEDHMYLAEEESFGPI 829

  Fly   415 VSIIRFRDE--EEAVKKANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGG 477
            :.|.:|:|.  :..:::||:|..|||...:::::.:...|:::|:.|.|.:|....:...|||||
 Frog   830 MVISKFKDGDIDGVLRRANNTEYGLASGVFTKDISKAMYVSEKLDAGTVFINTYNKTDVAAPFGG 894

  Fly   478 VKESGVGREGSKHGIDDYVDIKYI 501
            .|:||.|::..:..:.:|:..|.:
 Frog   895 FKQSGFGKDLGEEALHEYLRTKAV 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 166/460 (36%)
aldh1l2XP_002938116.1 FMT_core_FDH_N 23..225 CDD:187716
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..412 CDD:376348
ALDH_F1L_FTFDH 437..922 CDD:143458 171/479 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.