DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and CPR2

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:49/168 - (29%)
Similarity:74/168 - (44%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 FLDMEIAGELAGRVLIEVRSDAAPRMADNFGAL-VRHERGYGYRGCTVFQAWGGESIITGDFESQ 580
            |.|:|...|..||::|.:.....|:.|.||..| .......|:.|.|..:......:..|||...
Yeast    39 FFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGGDFTDG 103

  Fly   581 NGRGGHSAFESRYFLPDETGLPAH--RGTVGMRRGQRRQDRSGFVGSQFRLVLNEMRSFT----A 639
            .|.||.|.:...:  |||.....|  :|.:.|  ..|.:|.:   ||||.:...|..|:.    .
Yeast   104 TGVGGKSIYGDTF--PDENFTLKHDRKGRLSM--ANRGKDTN---GSQFFITTTEEASWLDGKHV 161

  Fly   640 IFGFIVQGIELVDRIA-ASGNALGRPALRSIIRNCGEY 676
            :||.:|.|:::|:.|. .|.:|..:|.....|..|||:
Yeast   162 VFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGEW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 46/164 (28%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 46/164 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.