DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and CPR8

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:46/203 - (22%)
Similarity:68/203 - (33%) Gaps:67/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TDHNSSECICNLCGYRTQLDGQQLPQSVTIMYLLRELPAL------------------ILGRAML 95
            ||..|||....|  ....|.|..:|:  |:|...:.:.::                  ||....:
Yeast    57 TDPESSEEAGRL--ITIDLYGTMVPK--TVMTFCQYVDSVKDRLASRHSYSPERDFDKILPNGAI 117

  Fly    96 DFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFLATSAEHCFIHAMPNSTWCHNCQRLL--CRA 158
            :.|...||:||.:...||..|.:|                |..||..|.........:.|  ...
Yeast   118 EGSSVSSSSIEETEMLAPKLPEEN----------------HSLIHDRPGRVSMIKDDKGLKFIIE 166

  Fly   159 CSDVPLHQDHILVRQV--DYHDLISQLLN-------------------SELRKIKSTAVHAKELA 202
            .|:.||..:.::..||  ...||:.:|.|                   |:..:|:    ||||  
Yeast   167 TSETPLEGESVVFGQVTAGLKDLMDKLANVKTDENGKPEQPITIGYISSQEHRIQ----HAKE-- 225

  Fly   203 THEMDLLR 210
            .||..|.|
Yeast   226 AHEKYLQR 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 5/9 (56%)
cyclophilin 514..674 CDD:294131
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 31/164 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.