DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ROC1

DIOPT Version :10

Sequence 1:NP_651406.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:175 Identity:52/175 - (29%)
Similarity:87/175 - (49%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 YPIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV-FQAWGGESIIT-- 574
            :|..:.||.|.|:.|||:::|:.:|..||.|:||.||...|:|.|..|..: |:......:|.  
plant     3 FPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPNF 67

  Fly   575 ----GDFESQNGRGGHSAFESRYFLPDETGLPAHR--GTVGMRRGQRRQDRSGFVGSQF---RLV 630
                |||.:.||.||.|.:.|::  .||.....|.  |.:.|.......:     ||||   .:.
plant    68 MCQGGDFTAGNGTGGESIYGSKF--EDENFERKHTGPGILSMANAGANTN-----GSQFFICTVK 125

  Fly   631 LNEMRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
            .:.:.....:||.:|:|:::|..|...|::.|:|....::.:||:
plant   126 TDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_651406.1 RING_Ubox 13..60 CDD:473075
Pro_isomerase 520..675 CDD:459694 49/166 (30%)
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 50/171 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.