DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ROC2

DIOPT Version :10

Sequence 1:NP_651406.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_191166.1 Gene:ROC2 / 824773 AraportID:AT3G56070 Length:176 Species:Arabidopsis thaliana


Alignment Length:175 Identity:58/175 - (33%)
Similarity:80/175 - (45%) Gaps:21/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYG-------YRGCTVFQAWGGES 571
            |..|.|:.|....||||::|:.:|..||.|:||.||...|.|.|       |:|....:...|..
plant     4 PKVFFDILIGKMKAGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAFHRIIPGFM 68

  Fly   572 IITGDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSG--FVGSQFRLVLNEM 634
            ...|||...||.||.|.:.|::  .||.....|.|.     |......||  ..|||| .:..|.
plant    69 CQGGDFTRGNGTGGESIYGSKF--EDENFKLKHTGP-----GILSMANSGPNTNGSQF-FICTEK 125

  Fly   635 RSFT----AIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
            .|:.    .:||.:|.|..:|..:...|:.:|.|:.|.:|.:|||
plant   126 TSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMGNPSERVVIEDCGE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_651406.1 RING_Ubox 13..60 CDD:473075
Pro_isomerase 520..675 CDD:459694 53/167 (32%)
ROC2NP_191166.1 cyclophilin_ABH_like 4..169 CDD:238907 55/172 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.