DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and SQN

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_565381.1 Gene:SQN / 816074 AraportID:AT2G15790 Length:361 Species:Arabidopsis thaliana


Alignment Length:173 Identity:51/173 - (29%)
Similarity:78/173 - (45%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 FLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYG--------YRGCTVFQAWGGESII 573
            |:|:.|.|||.||::||:..|..|:.|:||..|...|:|.|        |:|....:...|..|.
plant     7 FMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIKGFMIQ 71

  Fly   574 TGDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSG--FVGSQFRLV---LNE 633
            .||..:.:|.||.|.:..::  .||.....|.     |:|......||  ..||||.:.   .:.
plant    72 GGDISANDGTGGESIYGLKF--DDENFELKHE-----RKGMLSMANSGPNTNGSQFFITTTRTSH 129

  Fly   634 MRSFTAIFGFIVQGIELVDRIA-ASGNALGRPALRSIIRNCGE 675
            :.....:||.:.:|:.:|..|. .|......|:...:|.:|||
plant   130 LDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 48/170 (28%)
SQNNP_565381.1 cyclophilin_ABH_like 4..171 CDD:238907 48/170 (28%)
TPR_11 216..329 CDD:290150
TPR repeat 263..293 CDD:276809
TPR_2 298..331 CDD:285020
TPR repeat 298..326 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.