DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Ppil6

DIOPT Version :10

Sequence 1:NP_651406.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_082706.1 Gene:Ppil6 / 73075 MGIID:1920325 Length:313 Species:Mus musculus


Alignment Length:181 Identity:47/181 - (25%)
Similarity:71/181 - (39%) Gaps:39/181 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 FLDMEIAGELA--GRVLIEVRSDAAPRMADNFGALVRHERGYGYRGC-----------TVFQAWG 568
            |:.::|..:|:  ||::.|:..||.||...||..|.....|:..||.           .|...| 
Mouse   145 FVYLDICIDLSPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGTKLHYKDSIFHRVVQNGW- 208

  Fly   569 GESIITGDFESQNGRGGHS----AFESRYFLPDETGLPAH-RGTVGM-RRGQRRQDRSGFVGSQF 627
               |..||.....|..|.|    .||...|     .:|.: ||.:|| .:|....      ||||
Mouse   209 ---IQGGDIVQGRGDDGESIYGPTFEDENF-----SIPHNKRGVLGMVNKGHHTN------GSQF 259

  Fly   628 RLVLNEM----RSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCG 674
            .:.|...    :.:.| ||.:::|..::.::........||.|...|.:.|
Mouse   260 YITLQAAPYLDKKYVA-FGQLIEGTHVLKQLELVPTENERPLLLCSIADSG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_651406.1 RING_Ubox 13..60 CDD:473075
Pro_isomerase 520..675 CDD:459694 46/178 (26%)
Ppil6NP_082706.1 cyclophilin 146..309 CDD:469651 45/178 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.