DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and PPIAL4E

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001137504.2 Gene:PPIAL4E / 730262 HGNCID:33997 Length:164 Species:Homo sapiens


Alignment Length:175 Identity:41/175 - (23%)
Similarity:75/175 - (42%) Gaps:28/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 IYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFES 579
            :.|.::...|:..||:.|::.:|..|:.|:||.||...|:|:.|:|....:...|.....|||..
Human     5 VVFFEITRDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTR 69

  Fly   580 QNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFV----------GSQFRLVLNE- 633
            .||.|..|.:..::  .||..:..|.|             ||.:          ||||.:...: 
Human    70 PNGTGDKSIYGEKF--DDENLIRKHTG-------------SGILSMANAGPNTNGSQFFICAAKT 119

  Fly   634 --MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGEY 676
              :......||.:.:.:.:|:.:...|....:.:.:..|.:||::
Human   120 EWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 39/171 (23%)
PPIAL4ENP_001137504.2 cyclophilin 4..162 CDD:294131 39/171 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.