DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Ppil1

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:148 Identity:44/148 - (29%)
Similarity:64/148 - (43%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 GRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFESQNGRGGHSAFESR 592
            |.:::|:....||:...||..|.|  ||| |.| |.|.....:.:|.|...:..||||.|.:..:
Mouse    21 GVIVLELYWKHAPKTCKNFAELAR--RGY-YNG-TKFHRIIKDFMIQGGDPTGTGRGGASIYGKQ 81

  Fly   593 YFLPDE-------TGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNEMRSFT---AIFGFIVQG 647
            :  .||       ||    .|.:.|.......:     ||||.:.|...:...   .|||.:.||
Mouse    82 F--EDELHPDLKFTG----AGILAMANAGPDTN-----GSQFFVTLAPTQWLDGKHTIFGRVCQG 135

  Fly   648 IELVDRIA-ASGNALGRP 664
            |.:|:|:. ...|:..||
Mouse   136 IGMVNRVGMVETNSQDRP 153

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 44/148 (30%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 44/148 (30%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 1/10 (10%)