DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Ppil2

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_006522510.1 Gene:Ppil2 / 66053 MGIID:2447857 Length:564 Species:Mus musculus


Alignment Length:347 Identity:66/347 - (19%)
Similarity:128/347 - (36%) Gaps:62/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 ILTNYCVYAYWCEMQREMIPPRHRNLTPDPELLPEPRRAVVPPHFNNSLREVELLDY------VQ 390
            |.|...||.|....|..:.....|:|..|.   |..|:.::......:|.:..:.::      ::
Mouse   119 IRTTGNVYTYEAVEQLNIKAKNLRDLLTDE---PFSRQDIITLQDPTNLDKFNVSNFFHVKNNMR 180

  Fly   391 QIELEQFRTLSQPPYDGSHESSSSPNSSSSTNSQSNYIALDTEYGLRELVRQLQQQPQQVQQEQQ 455
            .|:.::.:....|.|           ...:|||       :|...|:||.::.:.........:.
Mouse   181 IIDPDEEKAKQDPSY-----------YLKNTNS-------ETRETLQELYKEFKGDEILAATMRP 227

  Fly   456 QQQQQVHQLTHSIYQPDAILVNSVEPQLIGQQSHDHHRQDGGTSSSVSIVRQPIVHCYPIYFLDM 520
            .::::|.||..:.|....:..:.....::.:.:|:           .:::.:.::.   ..|:..
Mouse   228 PEKKKVDQLNAAHYSTGKVSASFTSTAMVPETTHE-----------AAVIDEDVLR---YQFVKK 278

  Fly   521 EIAGEL---AGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFESQNG 582
            :....|   .|.:.:|:..|..|:..:||..|.:.:    |...|:|.......:|.|...:..|
Mouse   279 KGYVRLHTNKGDLNLELHCDLTPKTCENFIKLCKKQ----YYDGTIFHRSIRNFVIQGGDPTGTG 339

  Fly   583 RGGHSAFESRY---FLPD--ETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNEMRSFTAIFG 642
            .||.|.:...:   |.|:  .||    ||.:.|.......::|.|. ..||......:..| |||
Mouse   340 TGGESFWGKPFKDEFRPNLSHTG----RGVLSMANSGPNTNKSQFF-ITFRSCAYLDKKHT-IFG 398

  Fly   643 FIVQGIELVDRIAASGNALGRP 664
            .:|.|.   |.:.|..|....|
Mouse   399 RVVGGF---DTLTAMENVESDP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 39/159 (25%)
Ppil2XP_006522510.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418 11/42 (26%)
U-box domain, a modified RING finger 103..146 CDD:319361 8/26 (31%)
cyclophilin_RING 281..440 CDD:238904 38/150 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.