DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ppifb

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001032199.2 Gene:ppifb / 641328 ZFINID:ZDB-GENE-051030-126 Length:192 Species:Danio rerio


Alignment Length:178 Identity:54/178 - (30%)
Similarity:80/178 - (44%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV------FQAWGGESI 572
            |:.|.|:....:..|||..|:.:|..|:.|:||.||...|.|:||:|...      |...|    
Zfish    31 PVVFFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQG---- 91

  Fly   573 ITGDFESQNGRGGHSAFESRYFLPDETGLPAHRG-------TVGMRRGQRRQDRSGFVGSQFRLV 630
              |||.:.||.||.|.:..|:  |||.....|.|       ..|:...          ||||.:.
Zfish    92 --GDFTNHNGTGGKSIYGPRF--PDENFKLKHTGPGILSMANAGVNTN----------GSQFFIC 142

  Fly   631 LNE---MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
            ..:   :.....:||.:.:|:::|.::.|.|:..||.|.|..|.:|||
Zfish   143 TAKTEWLDGRHVVFGSVKEGMDVVRKVEALGSRSGRTAQRISITDCGE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 51/175 (29%)
ppifbNP_001032199.2 cyclophilin_ABH_like 31..189 CDD:238907 51/175 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.