DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and RANBP2

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_005264059.1 Gene:RANBP2 / 5903 HGNCID:9848 Length:3258 Species:Homo sapiens


Alignment Length:178 Identity:49/178 - (27%)
Similarity:84/178 - (47%) Gaps:10/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 VSIVRQPIVHCYPIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQA 566
            ||:..:......|:.|.|:...||..||:.:|:.|:..||.|:||.||...|:|:|::. ::|..
Human  3086 VSLAAELSKETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKN-SIFHR 3149

  Fly   567 WGGESIIT-GDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLV 630
            ...:.:.. ||....:|.||.|.:..::  .||.....|.|...:....:.|:.:   .|||.:.
Human  3150 VIPDFVCQGGDITKHDGTGGQSIYGDKF--EDENFDVKHTGPGLLSMANQGQNTN---NSQFVIT 3209

  Fly   631 LNEMRSFT---AIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
            |.:.....   .:|||:..|::.|.:|.:.|:..|....|..|..||:
Human  3210 LKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQ 3257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 45/163 (28%)
RANBP2XP_005264059.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.