DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Ppie

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_062362.1 Gene:Ppie / 56031 MGIID:1917118 Length:301 Species:Mus musculus


Alignment Length:174 Identity:54/174 - (31%)
Similarity:89/174 - (51%) Gaps:24/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV------FQAWGGESI 572
            |..::|::|..:.|||:.:.:|||..|..|:||..|..||:|:|::|.:.      |...|    
Mouse   140 PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQG---- 200

  Fly   573 ITGDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSG--FVGSQFRLVLNE-- 633
              |||.:.||.||.|.:..::  .||..:..|.|.     |......||  ..||||.|..::  
Mouse   201 --GDFTNHNGTGGKSIYGKKF--DDENFILKHTGP-----GLLSMANSGPNTNGSQFFLTCDKTD 256

  Fly   634 -MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGEY 676
             :.....:||.:.:|::::.:|.|.|:..|:|..:.:|.:||||
Mouse   257 WLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGEY 300

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 50/170 (29%)
PpieNP_062362.1 RRM <5..194 CDD:223796 19/53 (36%)
RRM_PPIE 8..80 CDD:240793