DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5071 and ppil4

DIOPT Version :9

Sequence 1:	NP_001303432.1	Gene:	CG5071 / 43090	FlyBaseID:	FBgn0039347	Length:	680	Species:	Drosophila melanogaster
Sequence 2:	NP_001121802.1	Gene:	ppil4 / 554886	ZFINID:	ZDB-GENE-030131-6251	Length:	454	Species:	Danio rerio

Alignment Length:	139	Identity:	37/139 - (26%)
Similarity:	64/139 - (46%)	Gaps:	21/139 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   528 GRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFESQNGRGGHSAF--- 589
            |.::|::.::..|:.:.||..|.: .:.|.|  |.:........|.||| .:..||||.|.|
Zfish    10 GDIVIDLYTEERPKASLNFLKLCK-IKYYNY--CLIHNVQRDFIIQTGD-PTGTGRGGESVFCKL 70

  Fly   590 ---ESRYFLPDETGLPAHR--GTVGMRRGQRRQDRSGFVGSQFRLVLNE----MRSFTAIFGFIV 645
               ::|:|..::.....||  |||.|......|.     ||||.:...|    :.....:||.:.
Zfish    71 YGDQARFFESEKMPRIKHRKKGTVSMVNNGSDQH-----GSQFLITTGENVDYLDGVHTVFGEVT 130

  Fly   646 QGIELVDRI 654
            :|::::.:|
Zfish   131 EGMDVLAKI 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5071	NP_001303432.1	RING	16..59	CDD:238093
CG5071	NP_001303432.1	cyclophilin	514..674	CDD:294131	37/139 (27%)
ppil4	NP_001121802.1	cyclophilin_RRM	4..169	CDD:238902	37/139 (27%)
		RRM	172..>320	CDD:223796
		RRM_PPIL4	237..319	CDD:240681
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0652
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900