DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ppie

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001017678.1 Gene:ppie / 550373 ZFINID:ZDB-GENE-050417-167 Length:302 Species:Danio rerio


Alignment Length:176 Identity:53/176 - (30%)
Similarity:86/176 - (48%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV------FQAWGGESI 572
            |..::|::|..:.|||:...:|:|..|..|:||..|..||:|:|::|.:.      |...|    
Zfish   141 PQVYMDIKIGNKPAGRLRFLLRADVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQG---- 201

  Fly   573 ITGDFESQNGRGGHS----AFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNE 633
              |||.:.||.||.|    .||...|:...|    |.|.:.|.......:     ||||.:.:::
Zfish   202 --GDFTNHNGTGGKSIYGRKFEDENFVLKHT----HAGQLSMANSGPNTN-----GSQFFITVDK 255

  Fly   634 ---MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGEY 676
               :.....:||.:.:|::::..:.|.|...|:|..:.||.|||||
Zfish   256 TDWLDGKHVVFGELTEGMDVLRAMEAQGTKDGKPKQKVIISNCGEY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 49/172 (28%)
ppieNP_001017678.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 141..299 CDD:238907 49/172 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.