DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim35

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001020313.2 Gene:Trim35 / 498538 RGDID:1564642 Length:515 Species:Rattus norvegicus


Alignment Length:361 Identity:76/361 - (21%)
Similarity:120/361 - (33%) Gaps:119/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KELKSLLSCGLCHRPY-DLATGLLPQELACRHSFCKKCVQRNTDHNSSEC-------ICNLCGYR 64
            :..|..|.|.:|:.|: |..|      |.|.|:||::||        |.|       .|.:|..|
  Rat    27 RSFKEELLCAVCYDPFRDAVT------LRCGHNFCRRCV--------SGCWEVQTTPSCPVCKER 77

  Fly    65 TQLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESF 129
            .      :|..:...:.|..|...:|.                  |||..:   .|..       
  Rat    78 A------VPGELRTNHTLNNLVETLLR------------------EEAEGA---RWTG------- 108

  Fly   130 LATSAEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHDLISQLLNSELRKIKST 194
             ..|...|..|..|.:.:|...:.|||.||.....||:|                  .::.||.|
  Rat   109 -RRSPRPCRAHRAPLTLFCVEDKELLCCACQADARHQEH------------------RVQPIKDT 154

  Fly   195 AVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAASMIGWHRLAE-----RDLHRVG 254
            |...:....:...:|||..::.:  .|....|.:..|:.:....:.|  |:.:     ||..||.
  Rat   155 AQDFRAKCKNMEHVLREKAKSFW--ALRRTYEAIAKHNEVQTTWLEG--RIRDEFDKLRDFLRVE 215

  Fly   255 R----------------LTGAKMLQVLAHLATQRQRYERQLDQVHFQCRMQAAIQENGMQVLDFE 303
            .                |...||.|    ||.|.:...|:::      |:|..::|:.|..|   
  Rat   216 EQATVDAMKEESRKKHLLAEEKMKQ----LAEQTEALAREIE------RLQMEMKEDDMTFL--- 267

  Fly   304 TLNNRIARLRSHRRPGAIPANVGPPQALILTNYCVY 339
                  .:.:|.:|.........|.|..:|.:.|.|
  Rat   268 ------MKHKSRKRRLFCTVEPAPLQPGLLMDACKY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 14/50 (28%)
cyclophilin 514..674 CDD:294131
Trim35NP_001020313.2 RING 35..76 CDD:238093 16/54 (30%)
BBOX 113..151 CDD:237988 12/55 (22%)
DUF4200 <198..261 CDD:290574 16/74 (22%)
SPRY 317..503 CDD:295394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.