DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ppif

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:173 Identity:56/173 - (32%)
Similarity:86/173 - (49%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV------FQAWGGESI 572
            |:.::|:....:..|||..|:|:|..|:.|:||.||...|:|:||:|.|.      |...|    
 Frog    39 PMVYMDLVADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKGSTFHRIIPNFMCQG---- 99

  Fly   573 ITGDFESQNGRGGHSAFESRYFLPDETGLPAHR--GTVGMRRGQRRQDRSGFVGSQFRLVLNE-- 633
              |||.:.||.||.|.:.||:  |||.....|.  |.|.|.......:     ||||.:...|  
 Frog   100 --GDFTNHNGTGGKSIYGSRF--PDENFFLKHTGPGVVSMANAGPNTN-----GSQFFICTVETE 155

  Fly   634 -MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
             :.:...:||.|..|.:::.:|.:.|:..|||:.:.::..|||
 Frog   156 WLDNKHVVFGCIKDGYDIMKKIESFGSKTGRPSKKVVVAECGE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 53/170 (31%)
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907 53/170 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.