DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Moca-cyp

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:176 Identity:50/176 - (28%)
Similarity:81/176 - (46%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYG--------YRGCTVFQAWGGE 570
            |..|.|:.:.|...||::.|:.:|.||:.|:||.||...|:|:|        |:|....:.....
  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77

  Fly   571 SIITGDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLN--- 632
            .:..|||.:.||.||.|.:...:  .||:....|.....:....|.::.:   ||||.:...   
  Fly    78 MVQAGDFSAGNGTGGESIYGGTF--EDESFEKKHDRPFLLSMANRGKNTN---GSQFFITTQPAP 137

  Fly   633 EMRSFTAIFGFIVQGIELV---DRIAASGNALGRPALRSIIRNCGE 675
            .:.:...:||.::.|.|||   :.:....|:  ||...:.|.||||
  Fly   138 HLDNIHVVFGQVISGQELVRQLEGLPVDRNS--RPLQDAAIANCGE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 47/173 (27%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 47/173 (27%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.