DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ppid

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001002065.1 Gene:ppid / 415155 ZFINID:ZDB-GENE-040625-34 Length:371 Species:Danio rerio


Alignment Length:184 Identity:52/184 - (28%)
Similarity:78/184 - (42%) Gaps:36/184 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYG--------YRGCTVFQAWGGE 570
            |..|.|:||..|..|||:.|:.:|..|:.|:||.||...|:|.|        ::||...:.....
Zfish    16 PRVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRIIKSF 80

  Fly   571 SIITGDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFV----------GS 625
            .|..|||.:|||.||.|.:..::  .||.....|             ||.|.:          ||
Zfish    81 MIQGGDFSNQNGTGGESIYGDKF--EDENFHYKH-------------DREGLLSMANAGPNTNGS 130

  Fly   626 QFRLV---LNEMRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGEY 676
            ||.:.   ...:.....:||.:::|:.:|..:.|.......|....:|..|||:
Zfish   131 QFFITTVPTPHLDGKHVVFGQVLKGMGVVKMLEAMETKEDNPVKPCVIAECGEH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 49/180 (27%)
ppidNP_001002065.1 cyclophilin_ABH_like 16..182 CDD:238907 49/180 (27%)
TPR_11 223..304 CDD:290150
TPR repeat 223..268 CDD:276809
TPR_12 271..340 CDD:290160
TPR repeat 273..303 CDD:276809
TPR repeat 308..336 CDD:276809
TPR_1 309..341 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.