DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and ppil2

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:297 Identity:58/297 - (19%)
Similarity:105/297 - (35%) Gaps:87/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 HFNNSLREVELLDYVQQIELEQFRTLSQPPYDGSHESSSSPNSSSSTNSQSNYIALDTEYGLREL 439
            |..|:::   :||               |..:.:.:..|....|::..::.....|..:|...||
Zfish   174 HVKNNMK---VLD---------------PDEEKAKQDPSYHLKSTNLETRETLAELYRDYKGDEL 220

  Fly   440 VRQLQQQPQQVQQEQQQQQQQVHQLTHSI--------------YQPDAILVNSVEPQLIGQQSHD 490
            :....::|   :.::..:....|..|..:              ::.|||..::|..|.:.::.:.
Zfish   221 LASTMKEP---EAKKTDKFNAAHYSTGRVSASFTSTAMAPATNHEADAIADDAVRYQYVKKKGYV 282

  Fly   491 H-HRQDGGTSSSVSIVRQPIVHCYPIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHER 554
            . |...|..:                                :|:..|..|:..:||..|.:  :
Zfish   283 RLHTNKGDLN--------------------------------VELHCDKVPKAGENFIKLCK--K 313

  Fly   555 GYGYRGCTVFQAWGGESIITGDFESQNGRGGHSAFESRY---FLPD--ETGLPAHRGTVGMRRGQ 614
            || |.| |||.......:|.|...:..|.||.|.:...:   |.|:  .||    ||.:.|....
Zfish   314 GY-YDG-TVFHRSIRNFMIQGGDPTGTGTGGESFWGKPFKDEFRPNLSHTG----RGILSMANSG 372

  Fly   615 RRQDRSGFVGSQFR--LVLNEMRSFTAIFGFIVQGIE 649
            ...::|.|. ..||  ..|:...|   :||.:|.|:|
Zfish   373 PNTNKSQFF-ITFRSCAYLDRKHS---VFGRVVGGLE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 37/143 (26%)
ppil2NP_957285.2 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 39/169 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.