DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and CG3492

DIOPT Version :10

Sequence 1:NP_651406.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster


Alignment Length:116 Identity:25/116 - (21%)
Similarity:48/116 - (41%) Gaps:8/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EGSLVLLKNHNAINYRTLDFLHETNQDYVVIGTIGMPGVGKSTVLNLLNTNLYAPDQSDNRKETI 139
            :|.:..|::.|.:..   |.:|.|:....:|    .|.:.|..|..:.|.: :.|.....|:.|.
  Fly   298 DGDIDDLESDNDLGE---DVMHATSDGERII----YPWMKKIHVAGVANGS-FQPGMEPKRQRTA 354

  Fly   140 FPVHSTLNVAGENEVRMHITEDRLILLDCSEPVFGHARKDFIQNEQDELKK 190
            :..|..|.:..|.....::|..|.|.:..:..:.....|.:.||.:.:.||
  Fly   355 YTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_651406.1 RING_Ubox 13..60 CDD:473075
Pro_isomerase 520..675 CDD:459694
CG3492NP_611914.1 Pro_isomerase 256..403 CDD:459694 23/112 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.