DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and cyp33

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:173 Identity:55/173 - (31%)
Similarity:87/173 - (50%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV------FQAWGGESI 572
            |..|.|:.|.|..|||:::.:|:|..|:.|:||..|..||:||||:||:.      |...|    
  Fly   139 PQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQG---- 199

  Fly   573 ITGDFESQNGRGGHSAFESRYFLPDETGLPAHR--GTVGMRRGQRRQDRSGFVGSQFRLVLNE-- 633
              |||.:.||.||.|.:..::  .||.....|.  ||:.|.......:     ||||.:...:  
  Fly   200 --GDFTNNNGTGGKSIYGKKF--NDENFNLKHNSFGTLSMANSGANTN-----GSQFFICTTKTD 255

  Fly   634 -MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
             :.:...:||.::.|.|:|.::...|:..|.|:.:.:|.:|||
  Fly   256 WLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 52/170 (31%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 52/170 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.