DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and CG7747

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:280 Identity:57/280 - (20%)
Similarity:102/280 - (36%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 EQFRTLSQPPYDGSHESSSSPNSSSSTNSQSNYIALDTEYGLRELVRQLQQQPQQVQQEQQQQQQ 459
            :..|.|::      .|.....|.:|......|   |:|    :|.:.||||..|..::|....::
  Fly   180 KNLRVLTE------EEQQERKNPASGRIKTMN---LET----KETLEQLQQDYQPAEEEASTSKR 231

  Fly   460 QVHQLTHSIYQPDAIL----------VNSVEPQLIGQQ--SHDHHRQDGGTSSSVSIVRQPIVHC 512
            ...:...:.|...|:.          |:.:|..:|...  .::..::.|....:.::        
  Fly   232 TADKFNAAHYSTGAVAASFTSTAMVPVSQIEAAIIDDDLVKYERVKKKGYVRLNTNL-------- 288

  Fly   513 YPIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDF 577
                           |.:.:|:..|..||..|||   ::| ...||....:|.......|:.|..
  Fly   289 ---------------GPLNLELFCDQTPRACDNF---IKH-CANGYYNNVMFHRSIRNFIVQGGD 334

  Fly   578 ESQNGRGGHSAFESRY---FLPDETGLPAHRGTVGMRRGQRRQDRSG--FVGSQFRLVLNEMRSF 637
            .:.:|.||.|.:..::   |.|:.|    |.|     ||......||  ..||||.:.....:..
  Fly   335 PTGSGSGGESIWGKKFEDEFKPNLT----HTG-----RGVLSMANSGPNTNGSQFFITYRSCKHL 390

  Fly   638 T---AIFGFIVQGIELVDRI 654
            .   .|||.:|.|::.:.::
  Fly   391 DGKHTIFGKLVGGLDTLQKM 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 36/149 (24%)
CG7747NP_611113.1 RING 25..238 CDD:302633 15/70 (21%)
cyclophilin_RING 281..439 CDD:238904 36/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.