DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim72

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001071143.1 Gene:Trim72 / 365377 RGDID:1562778 Length:477 Species:Rattus norvegicus


Alignment Length:370 Identity:82/370 - (22%)
Similarity:137/370 - (37%) Gaps:94/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQR----NTDHNSSECICNLCGYRTQL 67
            |..|:..|||.||.:.:|     .|....|.||||:.|:.|    ..|..:..|.|  |...|: 
  Rat     5 PGLLRQELSCPLCLQLFD-----APVTAECGHSFCRACLIRVAGEPADDGTVACPC--CQASTR- 61

  Fly    68 DGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFLAT 132
                 ||:::....|..|                                        ||.....
  Rat    62 -----PQALSTNLQLARL----------------------------------------VEGLAQV 81

  Fly   133 SAEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHDLI--------SQLLNSELR 189
            ...||..|..|.|.:|...:.|:|..|:.:..|:.|.|:...:.|..:        :||..:.:|
  Rat    82 PQGHCEEHLDPLSIYCEQDRTLVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKAQLQEACMR 146

  Fly   190 KIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAASMIGWHRLAERDLHRVG 254
            |.||.||...:|...| :.:|:. ......||...|..|....|.:           :|:..||.
  Rat   147 KEKSVAVLEHQLVEVE-ETVRQF-RGAVGEQLGKMRMFLAALESSL-----------DREAERVR 198

  Fly   255 RLTGAKMLQVLAHLAT---QRQRYERQLDQVHFQCRMQAAIQENGMQVLDFETLNNRIARLRSHR 316
            ...|..:.:.|:.|.:   |.::.|:.|::|        |.:.....::.|..:.:|:.::.|..
  Rat   199 GEAGVALRRELSSLNSYLEQLRQMEKVLEEV--------ADKPQTEFLMKFCLVTSRLQKILSES 255

  Fly   317 RPGAIPANVGPPQALILTNYCVYAYWCEMQREMIPPRHRNLTPDP 361
            .|   ||.: ..|..::::...:..|.:|.|.:: |....||.||
  Rat   256 PP---PARL-DIQLPVISDDFKFQVWKKMFRALM-PELEELTFDP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 14/46 (30%)
cyclophilin 514..674 CDD:294131
Trim72NP_001071143.1 RING 14..56 CDD:302633 15/48 (31%)
zf-B_box 81..121 CDD:279037 12/39 (31%)
SPRY 278..470 CDD:295394 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.