DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim11

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_006246567.1 Gene:Trim11 / 360534 RGDID:1305448 Length:467 Species:Rattus norvegicus


Alignment Length:389 Identity:85/389 - (21%)
Similarity:139/389 - (35%) Gaps:99/389 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESIQVPKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNLCGYRT 65
            |.:..:...|:...:|.:|   .|..|.  |....|.|:||::|::|..........|..|    
  Rat     1 MAAPDLSTNLQEEATCAIC---LDYFTD--PVMTDCGHNFCRECIRRCWGQPEGPYACPEC---- 56

  Fly    66 QLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFL 130
                             ||:.|    :..|..:...:...||:....|.||....|         
  Rat    57 -----------------REVSA----QRNLRPNRPLAKMAEMARRLHPPSPVPQGV--------- 91

  Fly   131 ATSAEHCFIHAMPNSTWCHNCQRLLCRAC--SDVPLHQDHILVRQVDYHDLISQLLNS--ELRKI 191
                  |..|..|.:|:|.:...|||..|  |:...|:...|....|  ||..:|..|  .|||.
  Rat    92 ------CAAHREPLTTFCGDDLSLLCPTCERSEHWAHRVRPLQEAAD--DLKGRLEKSLEHLRKQ 148

  Fly   192 KSTAVHAKELATHEMDLLRELCEACYRVQL----HVKREMLEHHSSMVAASMIGWHRLAERDLHR 252
            ...|:..:..|.....|.:::.|:..:..|    .::|.:.|....::       .:|.|.:|..
  Rat   149 MEDAMLFQAQAEETCALWQKMVESQRQNVLGEFERLRRLLAEEEQQLL-------QKLEEEELEV 206

  Fly   253 VGRL-TGAKMLQVLAHLATQRQRYERQLDQVHFQCRMQAAIQENGMQVLDFETLNNRIARLRSHR 316
            :.|| .||      |.|..|..:....:.::..:|::.|.    |:    .:.:.:.:.|::..:
  Rat   207 LPRLREGA------ARLGQQSTQLAALVSELESRCQLPAL----GL----LQDIKDALCRVQDVK 257

  Fly   317 --RPGAIPANVGPPQALILTNYCVYAYWCEMQREMIPPRHR---NLTPD---PEL-LPEPRRAV 371
              .|..:|        :.|...|......|..|     |.|   .|.||   ||| |.|.||:|
  Rat   258 LQPPAVVP--------MELRTVCRVPGLVETLR-----RFRGDITLDPDTANPELVLSEDRRSV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 11/42 (26%)
cyclophilin 514..674 CDD:294131
Trim11XP_006246567.1 zf-C3HC4_4 16..56 CDD:291880 12/44 (27%)
zf-B_box 87..127 CDD:279037 12/54 (22%)
SPRY_PRY_TRIM11 287..455 CDD:293983 11/22 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.