DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim69

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_006234918.2 Gene:Trim69 / 311373 RGDID:1305074 Length:577 Species:Rattus norvegicus


Alignment Length:426 Identity:82/426 - (19%)
Similarity:144/426 - (33%) Gaps:142/426 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VPKELKSLLSCGLCHRPY-DLATGLLPQELACRHSFCKKCVQRNTDHNSSECIC----NLCGYRT 65
            |.:::.:.|.|.||:..: |      |..|.|.|:||:.|:|......:.|..|    .||.|  
  Rat   109 VIQDITTELHCPLCNDWFRD------PLMLTCGHNFCQACIQNYWKMQAKETFCPECKMLCQY-- 165

  Fly    66 QLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFL 130
                    .:.|...:|.:|...|....:|              :..|..|.             
  Rat   166 --------SNCTFNLVLEKLVEKIKRLPLL--------------KGHPQCPE------------- 195

  Fly   131 ATSAEHCFIHAMPNSTWCHNCQRLLCRACSDVPL----HQDHILVRQVDYHDLISQLLNSEL--- 188
              ..|:..:.:.|:.       :::|..|.|..|    .:|.:.:.:.      .:....||   
  Rat   196 --HGENLKLFSKPDG-------KMICFQCKDARLSMGQSKDFLQISEA------VRFFTEELAIY 245

  Fly   189 -RKIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAASMIGWHRLAE---RD 249
             .::::|....:.|.|.:.|.:....:...::|.::..|.|:.|..:        |...:   .|
  Rat   246 QSQLQTTLKELQSLRTMQKDAIAAYKDNKIQLQQNLSLEFLKLHQFL--------HNKEKDILND 302

  Fly   250 LHRVGRLTGAKMLQVLAHLATQRQRYERQLDQVHFQC----RMQAAIQENGMQVLDFETLNNRIA 310
            |...|::...:|              :..|:|:..||    .|.|.||....|...|:.|.: |.
  Rat   303 LRDEGKVLNEEM--------------DANLNQIQEQCLLAKDMLANIQARMEQQNSFDFLTD-IT 352

  Fly   311 RLRSHRRPG---AIPANV-----------GPPQALILTNYCVYAYWCEMQREMIPPRHRNLTPDP 361
            :|..:...|   .:|..:           ||.|         |..|.||| .::.|....||.||
  Rat   353 KLLENMEKGMKTLVPRQLISKKLSLGRFKGPIQ---------YTIWREMQ-SILSPGPSQLTLDP 407

  Fly   362 E------LLPEPRRAVV-----------PPHFNNSL 380
            :      :|...|.:|.           |..|::|:
  Rat   408 KTAHPNLVLSNSRTSVCHGDVKQVMPDDPERFDSSV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 14/47 (30%)
cyclophilin 514..674 CDD:294131
Trim69XP_006234918.2 zf-C3HC4_4 119..159 CDD:291880 14/45 (31%)
SPRY 389..574 CDD:295394 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.