DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim39

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_017457122.1 Gene:Trim39 / 309591 RGDID:1303115 Length:608 Species:Rattus norvegicus


Alignment Length:405 Identity:82/405 - (20%)
Similarity:146/405 - (36%) Gaps:121/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESIQVPKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNLC---- 61
            :|::||.      .||.:|     |.....|..:.|.|:|||.|:.|..:....:..|.:|    
  Rat   132 LENLQVE------ASCSVC-----LEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCRKTS 185

  Fly    62 GYRTQLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINV 126
            .||:....:||...|.|.                    |:..|::..|.:               
  Rat   186 RYRSLRPNRQLGSMVEIA--------------------KQLQTVKRKIRD--------------- 215

  Fly   127 ESFLATSAEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVD----YHDLISQLLNSE 187
            ||.       |..|..|.|.:|:..|..:|..|:....|:.|.:|...|    |.:.:.:.|...
  Rat   216 ESL-------CSQHHEPLSLFCYEDQEAVCLICAISHTHRAHTVVPMDDATQEYKEKLQKCLEPL 273

  Fly   188 LRKIKS-TAVHAKE----------LATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAASMIG 241
            .:|::. |...|.|          :.:....:|:|..|      ||  |.:.|...::::     
  Rat   274 EQKLQEITCCKASEERKPGELKRLVESRRQQILKEFEE------LH--RRLDEEQQTLLS----- 325

  Fly   242 WHRLAERDLHRVGRLTGAKMLQVLAHLATQRQRYERQLDQVHFQCRMQAAIQENGMQVL-DFETL 305
              ||.|.:...:.||.     :..|||.      :|:.|..|....::....::|.::| |.::.
  Rat   326 --RLEEEEQDILQRLR-----ENAAHLG------DRRRDLAHLAAEVEGKCLQSGFEMLKDVKST 377

  Fly   306 NNRIARLRSHRRPGA---IPANVG--PPQALIL---TNYCVYAYWCEMQREMIPPRHRNLTPDPE 362
            ..:..::::......   :..|..  |.|...|   ....:...|      ::||  .::|.|||
  Rat   378 LEKCEKVKTMEVTSVSIELEKNFSHFPRQYFALRKILKQLIAPLW------LLPP--ADVTLDPE 434

  Fly   363 ------LLPEPRRAV 371
                  :|.|.|::|
  Rat   435 TAHPNLVLSEDRKSV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 11/42 (26%)
cyclophilin 514..674 CDD:294131
Trim39XP_017457122.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.