DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim58

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001178570.1 Gene:Trim58 / 303167 RGDID:1566174 Length:485 Species:Rattus norvegicus


Alignment Length:379 Identity:74/379 - (19%)
Similarity:127/379 - (33%) Gaps:83/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PQELACRHSFCKKCVQRNTDHNSSECICNLCGYRTQLDGQQLPQSVTIMYLLRELPALILGRAML 95
            |..:.|.||||.:|:....:.:.|......|   .|..|...|.|....   |:|.:|:      
  Rat    25 PISVDCGHSFCLRCISELCEKSDSAQGVYAC---PQCRGPFRPSSFRPN---RQLASLV------ 77

  Fly    96 DFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFLATSAEHCFIHAMPNSTWCHNCQRLLCRACS 160
                                   :.|..:.:.:..|.|.: |..|....|.:|...|.::|..|.
  Rat    78 -----------------------DTVRQLGLGTGHAGSRQ-CSRHGEDLSHFCEEDQAMVCWVCD 118

  Fly   161 DVPLHQDHILVRQVDYHDLISQLLNSELRKIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKR 225
            ..|.|:.|......:......::|...|..:|.   ..:|..|.|.::.::......:|::..:|
  Rat   119 TSPEHRSHRTEPLQEAASRYQRMLQVALELVKK---EMEEALTQEANVGKKTIIWKEKVEMQRQR 180

  Fly   226 EMLE---HHSSMVAASMIGWHRLAERDLHRVGRLTGAKMLQVLAHLATQRQRYERQLDQV-HFQC 286
            ..||   |...:.....:...||.|.:...:.||..::     ..||.|.:..:...::: ....
  Rat   181 FRLEFEKHRGFLAQEEQLQLRRLEEEERATLQRLRDSR-----NRLAQQNKALKELAEELEEMSQ 240

  Fly   287 RMQAAIQENGMQVLDFETLNNRIARLRSHRRPGAIPANVGPPQALILTNYCVYAYWCEMQRE-MI 350
            |...|:.|....||   |.:..:.||    .|.|:|        :.|...|......||.|: .:
  Rat   241 RPAVALLEGARGVL---TRSEAMTRL----EPEAVP--------MELKTVCRIPGMREMLRKFQV 290

  Fly   351 PPRHRNLTPDPELLPEPRRAVVPPHFNNSLREVELLDYVQQIELEQFRTLSQPP 404
            ..:....|..|.||           ....||.|:        :.|.:|.:...|
  Rat   291 DVKLDPATAHPSLL-----------LTTDLRSVQ--------DAEVWRDVPSNP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 8/27 (30%)
cyclophilin 514..674 CDD:294131
Trim58NP_001178570.1 zf-C3HC4_4 15..58 CDD:291880 9/35 (26%)
BBOX 90..131 CDD:197662 12/41 (29%)
SPRY_PRY_TRIM58 291..458 CDD:293988 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.