DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim31

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001099846.1 Gene:Trim31 / 294208 RGDID:1308607 Length:507 Species:Rattus norvegicus


Alignment Length:356 Identity:63/356 - (17%)
Similarity:123/356 - (34%) Gaps:118/356 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESIQVPKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNLCGYRT 65
            |...::..:|:..::|.:|     |.....|..:.|.|:||.||:.: ....|...:|.||    
  Rat     1 MADPKMASQLQEDVTCPIC-----LEILQDPVTIDCGHNFCLKCINQ-IGKTSENILCPLC---- 55

  Fly    66 QLDGQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFL 130
                                                    :.|:.:....|:|          .|
  Rat    56 ----------------------------------------KCSVSKNTFRPNK----------LL 70

  Fly   131 ATSAE-----------------HCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHD 178
            |:.||                 .|..|......:|.....|||..|.|   .:||      .:||
  Rat    71 ASLAEKIQTMDPADIQQEKEEARCQKHKKKLYYFCEQDGALLCVVCRD---SKDH------KFHD 126

  Fly   179 --LISQLLNSELRKIKSTAVHAKELATHEMDLLRELCEA-----CYRVQLHV-KREMLEHHSSMV 235
              ||.:.:.:...:|:|   .|::|...:.:::.|....     .:|.|:.: |.:::|....: 
  Rat   127 VTLIDEAVQNYKVQIES---QAQDLGRKDKEIIEEKKRGEGAIWTFRAQVELEKLKVIEEFKHL- 187

  Fly   236 AASMIGWHRLAERDLHRVGRL-----TGAKMLQVLAHLATQRQRYERQLDQVHFQCR-MQAAIQE 294
                  ..||.|.:...:.|:     .|||.|.....:.      |:||:.:....: ::..:|.
  Rat   188 ------RQRLDEEESFLLSRMDWLEKQGAKQLGQYVTVT------EKQLNSLRTLTKSLKIRLQS 240

  Fly   295 NGMQVLDFETLNNRIARLRSHRRPGAIPANV 325
            :.:::|  :.:.:.::|.:..:....||..|
  Rat   241 SSIELL--KDIKDTLSRNKEFQFLSPIPVPV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 11/42 (26%)
cyclophilin 514..674 CDD:294131
Trim31NP_001099846.1 zf-C3HC4_4 16..55 CDD:291880 12/44 (27%)
zf-B_box 89..130 CDD:279037 12/49 (24%)
Phage_Mu_Gam 163..>274 CDD:295047 21/122 (17%)
SPRY 335..505 CDD:295394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.