DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and Trim50

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_006249190.1 Gene:Trim50 / 288596 RGDID:631346 Length:484 Species:Rattus norvegicus


Alignment Length:391 Identity:87/391 - (22%)
Similarity:136/391 - (34%) Gaps:105/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQVPKELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNLCGYRTQLD 68
            :.|| ||:..|.|.:|     |.....|..|.|.||:||.|:...::|..||..|.:|  |..:|
  Rat     5 LTVP-ELQDQLQCPIC-----LEVFKEPLMLQCGHSYCKNCLDSLSEHLDSELRCPVC--RQSVD 61

  Fly    69 GQQLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFLATS 133
            ....|.:|:   |.|.:.||.|                      |..                |.
  Rat    62 CSSSPPNVS---LARVIDALRL----------------------PGD----------------TE 85

  Fly   134 AEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILV------------------------RQV 174
            ...|..|..|.|.:|...|..:|..|..:..||.|.:.                        |.|
  Rat    86 PTVCVHHRNPLSLFCEKDQEFICGLCGLLGSHQHHRVTPVSTVYSRMKEELAGRLSELKEQHRDV 150

  Fly   175 DYHDLISQLLNSELRKIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKR--EMLEHHSSMVAA 237
            :.|  |.:|:|:..|.|..:.|.:       ..:.||..|..:.|.....|  |.:|.|:..:.|
  Rat   151 EEH--IGKLVNNRTRIINESDVFS-------WVIRREFQELHHLVDEEKARCLEGVESHTRGLVA 206

  Fly   238 SMI--------GWHRL--AERDLHRVGRLTGAKMLQVLAHLATQRQRYE--RQLDQVHFQCRMQA 290
            |:.        ...||  |||.|.:.|..:..:.::.. |..|.|...:  |.|:.|......:.
  Rat   207 SLDMQLEQAQGTQERLAQAERVLEQFGNESHHEFIRKF-HSITSRGEVQQARPLEGVFSPISFKP 270

  Fly   291 AIQENGMQVLDFETLNNRIARLRSHRRPGAI---PANVGPPQALILTNYCVYAYWCEMQREMIPP 352
            |:.:..:::..::.|..::.     ..|.::   ||...|...|...|..|:......:|...|.
  Rat   271 ALHQADIKLTVWKRLFRKVL-----PAPESLKLDPATAHPLLELSKGNTVVHCGLLAQRRASQPE 330

  Fly   353 R 353
            |
  Rat   331 R 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 14/42 (33%)
cyclophilin 514..674 CDD:294131
Trim50XP_006249190.1 RING 15..60 CDD:238093 17/51 (33%)
BBOX 90..125 CDD:237988 10/34 (29%)
iSH2_PI3K_IA_R 134..>225 CDD:304922 21/99 (21%)
SPRY_PRY_TRIM50 283..471 CDD:293977 11/54 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.