DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and PPIL6

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001104768.2 Gene:PPIL6 / 285755 HGNCID:21557 Length:337 Species:Homo sapiens


Alignment Length:412 Identity:89/412 - (21%)
Similarity:131/412 - (31%) Gaps:135/412 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 AIPANVGPPQALI---------LTNYCVYAYWC------EMQREMIPPRHRNLTPDPELLPEPRR 369
            |.|...|||.|..         |....|..:.|      :...|.:...|.:...||.|:|    
Human     2 ARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVP---- 62

  Fly   370 AVVPPHFNNSLREVELLDYVQQIELEQFRTLSQPPYDGSHESSSSPNSSSSTNSQSNYIALDTEY 434
                      |:|.....|:|    |:.|.|....:    |.|||  ..|..|.|....|||.  
Human    63 ----------LQEFAWHQYLQ----EKKRELKNETW----EYSSS--VISFVNGQFLGDALDL-- 105

  Fly   435 GLRELVRQLQQQPQQVQQEQQQQQQQVHQLTHSI-YQPDAI---LVNSVEPQLIGQQSHDHHRQD 495
                                   |:..|::...: .:|.|:   |......:.:....||     
Human   106 -----------------------QKWAHEVWDIVDIKPSALYDALTEDFSAKFLRDTKHD----- 142

  Fly   496 GGTSSSVSIVRQPIVHCYPIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRG 560
                               ..|||:.|.....||::.|:..|..|:...||..|...:.|:..||
Human   143 -------------------FVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRG 188

  Fly   561 C------TVF-----QAW------------GGESIITGDFESQNG---RGGHSAFESR------Y 593
            .      ::|     ..|            .||||....||...|   |......|||      .
Human   189 IRLHYKNSIFHRIVQNGWIQGGDIVYGKGDNGESIYGPTFEELYGSLKRSVKRQKESRGVGKIEK 253

  Fly   594 FLPDETGLPAH-RGTVGMRRGQRRQDRSGFVGSQFRLVLNEM----RSFTAIFGFIVQGIELVDR 653
            :..:...:|.: ||.:||....|..:     ||||.:.|...    |.|.| ||.:::|.|::.:
Human   254 YRDENFSVPHNKRGVLGMANKGRHSN-----GSQFYITLQATPYLDRKFVA-FGQLIEGTEVLKQ 312

  Fly   654 IAASGNALGRPALRSIIRNCGE 675
            :........||.....|.:.|:
Human   313 LELVPTQNERPIHMCRITDSGD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 49/196 (25%)
PPIL6NP_001104768.2 cyclophilin 144..333 CDD:412213 49/194 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.