DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and cyn-1

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_506561.1 Gene:cyn-1 / 179936 WormBaseID:WBGene00000877 Length:192 Species:Caenorhabditis elegans


Alignment Length:172 Identity:53/172 - (30%)
Similarity:80/172 - (46%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 PIYFLDMEIAGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTV-FQAWGGESIIT--- 574
            |..|.|:.|..|.||||.:|:.:|..|:.|:||.||...|:|.|.:|..: |:......||.   
 Worm    22 PKVFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIPEFM 86

  Fly   575 ---GDFESQNGRGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNE--- 633
               |||...||.||.|.:.:::  .||.....|.|...:.......:.:   ||||.:...:   
 Worm    87 IQGGDFTRHNGTGGESIYGNKF--KDENFDLKHTGPGCLSMANAGPNTN---GSQFFICTVDTPW 146

  Fly   634 MRSFTAIFGFIVQGIELVDRIAASGNALGRPALRSIIRNCGE 675
            :.....:||.:..|:.:|.:|...|:..|.||....|.:|||
 Worm   147 LDGGHVVFGQVTDGMSVVKKIEKMGSRSGAPAKTVTIADCGE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 50/169 (30%)
cyn-1NP_506561.1 cyclophilin_ABH_like 22..187 CDD:238907 50/169 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.