DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and LOC101730305

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_004920172.2 Gene:LOC101730305 / 101730305 -ID:- Length:542 Species:Xenopus tropicalis


Alignment Length:342 Identity:72/342 - (21%)
Similarity:112/342 - (32%) Gaps:142/342 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHNSSECICNLCGYRTQLDGQQLP 73
            :|:..|||.:|.   |:.|.  |..|.|.|:||:.|:.:..|.                      
 Frog     5 DLRDELSCSICR---DIYTD--PVSLPCGHNFCRGCIGKTWDW---------------------- 42

  Fly    74 QSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPS-----------KNWVEDINV- 126
                                            :.||||.||.|.           |..:...|: 
 Frog    43 --------------------------------QKSIEEDPSCPECRQRYRRQPELKRNLRLSNIA 75

  Fly   127 ESFLATSAEH---------CFIHAMPNSTWCHNCQRLLCRACSDVPLHQ---DHILVRQVDYHDL 179
            |.||:|..||         |..:.:|.:..|..|:..||.|  .|.:|.   :|:|....     
 Frog    76 ERFLSTHPEHDGTGIYCTYCIHYPVPAAQSCLQCEASLCDA--HVRVHSKSAEHVLTEPT----- 133

  Fly   180 ISQLLNSELRKIKSTAVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSMVAAS--MIGW 242
             :.|.|             ::.:.|...|....||                ..:.:.||  :.|.
 Frog   134 -ANLGN-------------RKCSAHNEPLKYLCCE----------------DGAPICASCCLAGG 168

  Fly   243 HRLAERDLHRVGRLTGA------KMLQVLAHLATQRQRYER---QLDQVHFQCRMQAAIQENGMQ 298
            ||     .|||..|:.|      |:.:||..|:.:|:..||   :|.:...:...:|||:...:.
 Frog   169 HR-----GHRVELLSEASEKKKEKLRKVLEKLSPEREETERGAQRLQERRRELEEKAAIETERVT 228

  Fly   299 VL------DFETLNNRI 309
            .|      :.|.|..|:
 Frog   229 ALFRGIREELEALEKRL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 12/42 (29%)
cyclophilin 514..674 CDD:294131
LOC101730305XP_004920172.2 RING_Ubox 10..56 CDD:418438 21/104 (20%)
Bbox_SF 92..132 CDD:412124 11/41 (27%)
Bbox2_TRIM16-like 139..185 CDD:380827 14/66 (21%)
BBC 184..310 CDD:128778 15/62 (24%)
SPRY_PRY_C-I_2 372..541 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.