DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and LOC100491243

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_012809394.2 Gene:LOC100491243 / 100491243 -ID:- Length:526 Species:Xenopus tropicalis


Alignment Length:333 Identity:74/333 - (22%)
Similarity:114/333 - (34%) Gaps:126/333 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCV--QRNTDHNSSECICNLCGYRTQLDGQQ 71
            :|:..|||.:|     |:....|..|.|.|:||..|:  ..:|...|....|..|..:.|     
 Frog     5 DLRDELSCSIC-----LSVYTDPVTLPCGHNFCHGCIGGLLDTQEGSGGYSCPECRAKFQ----- 59

  Fly    72 LPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINV-ESFLATSAE 135
                        |.|||           :|::|:.                  |: |.|.:|..|
 Frog    60 ------------ERPAL-----------QRNTTLG------------------NLAELFFSTHPE 83

  Fly   136 H---------CFIHAMPNSTWCHNCQRLLCRACSDVPLHQ---DHILVRQVDYHDLISQLLNSEL 188
            |         |....:|.:..|..|:..||.|  .|.:|.   :|:|...            :.|
 Frog    84 HDGTGIYCTYCINSPVPAAKSCILCEASLCDA--HVRVHSKSAEHVLTEP------------TAL 134

  Fly   189 RKIKSTAVHAKELATHEMDLLRELCE--ACYRVQLHVKREMLEHHSSMVAASMIGWHRLAERDLH 251
            ..|| .:||.|.|..:       .||  ||.                .|:..:.|.||     .|
 Frog   135 ENIK-CSVHHKFLEYY-------CCEDGACI----------------CVSCCLAGEHR-----GH 170

  Fly   252 RVGRLTGAK------MLQVLAHLATQRQRYER---QLDQVHFQCRMQAAIQENGMQVL------D 301
            ||..|:.|.      :.:||.:|:.:|:..||   :|.:...:...:||.:...:..|      :
 Frog   171 RVELLSEASEKKKETLRKVLENLSPEREETERGAQRLLESWREVEEKAAAETERVTALFRGIREE 235

  Fly   302 FETLNNRI 309
            .|.|..|:
 Frog   236 LEALEKRL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 12/44 (27%)
cyclophilin 514..674 CDD:294131
LOC100491243XP_012809394.2 RING_Ubox 10..55 CDD:418438 15/49 (31%)
Bbox_SF 91..131 CDD:412124 11/41 (27%)
Bbox2_TRIM16-like 138..183 CDD:380827 18/73 (25%)
BBC 182..293 CDD:128778 13/62 (21%)
SPRY_PRY_C-I_2 357..524 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5302
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.