DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and trim25l

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_002942762.2 Gene:trim25l / 100490741 XenbaseID:XB-GENE-17329851 Length:525 Species:Xenopus tropicalis


Alignment Length:338 Identity:68/338 - (20%)
Similarity:109/338 - (32%) Gaps:114/338 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQR--NTDHNSSECICNLCGYRTQLDGQQ 71
            :|:..|:|.:|...|.     .|..|.|.|:||:.|:.|  :|...:....|..|       ..:
 Frog     6 DLREELNCSVCLSIYS-----DPIMLPCGHNFCQGCIGRVLDTQEGTGVYTCPEC-------RAE 58

  Fly    72 LPQSVTIMYLLRELPALILGRAMLDF---------------------------SYKRSSTIEMSI 109
            .|          |.|||...|.:.:.                           :.|.....|.|:
 Frog    59 YP----------ERPALQRNRTLGNIAERFLCAQPGPGGTGIYCTYCIHSPVAAAKSCLLCEASL 113

  Fly   110 EEAPSSPSKNWVEDINVESFLATSAEHCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQV 174
            .|:.........|.:.||...|.....|..|..|...:|:.....:|.:|.....|:.|.:    
 Frog   114 CESHVRVHSRSAEHVLVEPTTAPEKRKCSAHGEPLKYYCYEDSACICASCCLGGQHKRHRV---- 174

  Fly   175 DYHDLISQ------------LLNSEL---------RKIKSTAVHAKELATHEMD----LLRELCE 214
               :|:|:            |||..|         :|::...|..:|.|..|||    |..::  
 Frog   175 ---ELLSEASDRKKEQLRKVLLNLPLMIEETERGAQKLQERRVQMQEQAAGEMDRVVALFADI-- 234

  Fly   215 ACYRVQLHVKREMLEHHSSMVAASMIGWHRLAERDLHRVGR----LTGAKMLQVLAHLATQRQRY 275
                      ||.||              .|..|.|..:.|    || |:..:::..|..:::..
 Frog   235 ----------RERLE--------------ALERRVLSEIARQEEELT-ARASELIHQLEIKKEEL 274

  Fly   276 ERQLDQVHFQCRM 288
            .|::.|....|.|
 Frog   275 SRKILQTEELCNM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 12/44 (27%)
cyclophilin 514..674 CDD:294131
trim25lXP_002942762.2 RING_Ubox 10..56 CDD:418438 15/57 (26%)
Bbox_SF 92..132 CDD:412124 6/39 (15%)
Bbox2_TRIM16-like 139..185 CDD:380827 10/52 (19%)
BBC 184..295 CDD:128778 28/131 (21%)
SPRY_PRY_C-I_2 352..514 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5302
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.