DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and LOC100489697

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_002940232.3 Gene:LOC100489697 / 100489697 -ID:- Length:546 Species:Xenopus tropicalis


Alignment Length:411 Identity:79/411 - (19%)
Similarity:125/411 - (30%) Gaps:168/411 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCV--QRNTDHNSSECICNLCGYRTQLDGQQ 71
            :|:..|||.:|     |:....|..|.|.|:||:.|:  ...|...|....|..|....|     
 Frog     5 DLRDELSCSIC-----LSIYTDPVSLPCGHNFCRGCIGLVLGTQEGSGAYSCPECRAEYQ----- 59

  Fly    72 LPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFLATSAE- 135
                        |.|||...||:.:.:                            |.|..|..| 
 Frog    60 ------------ECPALPRNRALGNIA----------------------------ERFRPTETEP 84

  Fly   136 --------HCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHDLISQLLNSELRKIK 192
                    :|.:..:|.:..|..|:...|                            |..||...
 Frog    85 GETGIFCTYCLLSPVPAAKSCLLCEASFC----------------------------NKHLRGHS 121

  Fly   193 STAVHAKELATHEMDLLRELCEACYRVQLHVKREMLEHHSSM------VAASMIGWHRLAERDLH 251
            .:|.|.  |.......:...|.        |..::||:|..:      |:..:.|.||     .|
 Frog   122 QSAEHV--LTEPTASFMGRKCS--------VHHKVLEYHCCVDSACICVSCCLAGGHR-----GH 171

  Fly   252 RVGRLTGA------KMLQVLAHLATQRQRYERQLDQVHFQCRMQAAIQENGMQVLDFETLNNRIA 310
            ||..|:.|      |:.:||..|:::|:..||                  |.|            
 Frog   172 RVELLSEASEKKKEKLRKVLEKLSSEREETER------------------GAQ------------ 206

  Fly   311 RLRSHRRPGAIPANVGPPQALILTNYCVYAYWCEMQREMIPPRHRNLTPDPELLPEPRRAVVPPH 375
            ||:..||...|.| .|                   :|:.:....|::..:.|.|  .:|.:....
 Frog   207 RLQERRRESEIKA-AG-------------------ERKRVTALFRSIREELEAL--EKRLLSDIS 249

  Fly   376 FNNSLREVELLDYVQQIELEQ 396
            .......::|.|.:||:|:::
 Frog   250 RQREELSLQLKDLIQQLEIKK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 12/44 (27%)
cyclophilin 514..674 CDD:294131
LOC100489697XP_002940232.3 RING_Ubox 9..55 CDD:418438 15/50 (30%)
Bbox_SF 91..131 CDD:412124 11/69 (16%)
Bbox2_TRIM16-like 138..184 CDD:380827 14/58 (24%)
BBC 183..309 CDD:128778 26/140 (19%)
SPRY_PRY_C-I_2 359..526 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5302
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.