DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5071 and LOC100489639

DIOPT Version :9

Sequence 1:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_002939598.3 Gene:LOC100489639 / 100489639 -ID:- Length:465 Species:Xenopus tropicalis


Alignment Length:296 Identity:61/296 - (20%)
Similarity:95/296 - (32%) Gaps:85/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELKSLLSCGLCHRPYDLATGLLPQELACRHSFCKKCVQRNTDHN---SSECICNLCGYRTQLDGQ 70
            ||.:.|:|.:|...|.     .|..|.|.||||..|:.:..|..   ..:..|.:|  |.|    
 Frog     5 ELTNDLTCSVCQEIYK-----EPVTLPCGHSFCIPCIGKTWDEQHRIEEDASCPVC--RKQ---- 58

  Fly    71 QLPQSVTIMYLLRELPALILGRAMLDFSYKRSSTIEMSIEEAPSSPSKNWVEDINVESFLATSAE 135
                                        |||...:..:|      ...|..|.|..|:      .
 Frog    59 ----------------------------YKRKPELNRNI------ALHNIAEQILPEN------T 83

  Fly   136 HCFIHAMPNSTWCHNCQRLLCRACSDVPLHQDHILVRQVDYHDLISQLLNSELRKIKSTAVHAKE 200
            .|..|.......|.:...|:|.:|..|..|:.|    ||:..|...:....:||::.......||
 Frog    84 KCSAHNKHLKYHCSDDGALICESCCHVGDHKGH----QVESLDKAFEKQKEKLREVWKKLTPEKE 144

  Fly   201 LATHEMDLLRE--------LCEACYRVQLHVK--REMLEHHSSMVAASMIGWHRLAERDLHRVGR 255
            ....::..|:|        |.....||....|  :||||              .|.::.|..:..
 Frog   145 KTEGQVQRLQENRKKVEEILAGETERVTTLFKEIKEMLE--------------ALEKKSLDEISE 195

  Fly   256 LTGAKML---QVLAHLATQRQRYERQLDQVHFQCRM 288
            |....:|   .::..|.|::.....::..:...|.|
 Frog   196 LLKRHLLPFTDLIQQLETKKGELSMKICNIKNLCNM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5071NP_001303432.1 RING 16..59 CDD:238093 12/45 (27%)
cyclophilin 514..674 CDD:294131
LOC100489639XP_002939598.3 RING_Ubox 10..56 CDD:418438 15/52 (29%)
Bbox2_TRIM16-like 84..129 CDD:380827 12/48 (25%)
BBC 128..248 CDD:128778 22/118 (19%)
SPRY_PRY_C-I_2 299..464 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5302
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.