DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5079 and mink1

DIOPT Version :10

Sequence 1:NP_651405.1 Gene:CG5079 / 43089 FlyBaseID:FBgn0039346 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_021331645.1 Gene:mink1 / 100038799 ZFINID:ZDB-GENE-060526-45 Length:1314 Species:Danio rerio


Alignment Length:103 Identity:29/103 - (28%)
Similarity:59/103 - (57%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QQHTKPSPLRASASSWQLSNAAFKSR---LQQQQLLHQHQQQIQQQQHEQQQQEQQQQQEQQQQQ 92
            ||..|.   |:.|...|.:..|.:.|   ..::||||..|::|::|:.::::.|:||::|::..:
Zfish   359 QQENKE---RSEALKRQQAQLAAQRRDPEEHKRQLLHDRQKRIEEQKEQRRRLEEQQRKEREMVR 420

  Fly    93 QQHEGASHQEVQPNR--EERRVVGQKTKLQTANIKKKI 128
            ||.:.|.|:.:...|  |:||:..::.:.    |:.|:
Zfish   421 QQQDKAPHRRLDDMRREEDRRLAEREQEF----IRHKL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5079NP_651405.1 None
mink1XP_021331645.1 STKc_MAP4K4_6_N 8..289 CDD:270806
CNH 996..1294 CDD:214481
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.